PNC-27
p53/HDM-2-derived research peptide · preclinical only · FDA-warned
PNC-27 is a synthetic 'chimeric' research peptide with an unusually clever design. Most cancer drugs struggle with selectivity — hitting tumor cells without poisoning healthy ones — and PNC-27 attacks that problem from a different angle: it fuses a fragment of the tumor-suppressor protein p53 (residues 12–26) to a membrane-anchoring leader, so instead of switching a pathway on or off it physically targets the cell membrane. The hook is a quirk the originating researchers describe — the protein HDM-2, normally found inside cells, appears on the outer membrane of cancer cells but not normal ones. PNC-27's p53 segment binds that surface HDM-2 and the peptide then forms transmembrane pores, rupturing the cancer cell by necrosis while sparing cells that don't display HDM-2 outside. In cell culture and in tumor-bearing mice, that selective cancer-cell lysis is what the researchers reported. Context, stated plainly: this is preclinical work, almost entirely from one laboratory, with no independent replication of the anticancer result, no human trials, and no established human dose — and because it has been sold and misused, the FDA issued a 2017 safety alert against it and a fatal case report exists (details under Safety). PNC-27 is research material, not a cancer treatment, and this page makes no therapeutic claim.
The short version
PNC-27 is an experimental peptide with an elegant idea behind it. Chemotherapy's central problem is selectivity — killing cancer cells without wrecking healthy ones. PNC-27 goes after that by exploiting a quirk its researchers describe: a protein called HDM-2, normally tucked inside cells, shows up on the outer surface of cancer cells. PNC-27 is built to grab that surface marker and then tear holes in the membrane, so the cancer cell bursts while neighboring normal cells — which don't wear HDM-2 on the outside — are left alone.
What makes it unusual is that it doesn't try to flip a biological switch like most drugs; it physically punctures the cell. In lab dishes and in mice carrying human tumors, the originating group reported exactly that — cancer cells dying by rupture while normal cells survived. It is a genuinely interesting approach to the selectivity problem.
The honest context: this is early-stage laboratory science, almost all from one lab, never independently reproduced for the anticancer result and never tested in a human trial — so there is no proven human benefit and no established dose. It is sold only as a research chemical; the FDA warned against using it in 2017 (a sold batch was contaminated) and a death has been reported during use. Fascinating to follow, not a treatment to use — and nothing here is medical advice or a dose.
Molecular identity
Specs
- Molecular weight
- ≈ 4032 g/mol
- Molecular formula
- C188H293N53O44S
- Monoisotopic mass
- 4029.2040 Da
- PubChem CID
- 16201774
- CAS number
- 1159861-00-3
- Human clinical trials
- None — 0 registered
- Sequence (32 aa)
- PPLSQETFSDLWKLLKKWKMRRNQFWVKVQRGPubChem CID 16201774 / PMID 20080680
- Structure / class
- Chimeric p53(12–26)–HDM-2-binding peptide + Antennapedia membrane-residency peptide (MRP)PMID 20080680
- Construct
- p53 residues 12–26 (PPLSQETFSDLWKLL) fused to an Antennapedia-derived membrane-residency leader (KKWKMRRNQFWVKVQRG) — not classic penetratinPMID 20080680
- Molecular target
- Membrane-localized HDM-2 (MDM2) on cancer cells → transmembrane pore formation / necrosisPMID 20080680 / PMID 35625682
- Half-life
- Not established (no human pharmacokinetic data)Not established
- Regulatory status
- Research chemical; no human trials; not FDA-approved (FDA safety alert, Jan 2017, warned the public not to use it); sold as research material onlyFDA / ClinicalTrials.gov
- Evidence tier
- Preclinical only (in vitro + nude mice); single research group; the anticancer result is not independently replicatedResearch literature
Plain English
Mechanism
PNC-27 is a 32-amino-acid chimeric peptide. The first part is residues 12–26 of human p53 (PPLSQETFSDLWKLL) — the segment of the tumor-suppressor that normally binds HDM-2 (also called MDM2), the protein that keeps p53 in check. The second part is a 17-residue membrane-residency leader (KKWKMRRNQFWVKVQRG) derived from the Antennapedia homeodomain. (This leader is often loosely called 'penetratin,' but it is not the classic penetratin sequence, RQIKIWFQNRRMKWKK — a common mislabel worth correcting.)
The mechanism proposed by the originating group: HDM-2 is aberrantly expressed in the plasma membrane of cancer cells but not in the membrane of normal cells. PNC-27's p53 segment binds that membrane HDM-2; the bound peptide molecules then diffuse and fuse within the membrane to form transmembrane pores, causing rapid necrosis — the cell spills its contents (measured as lactate-dehydrogenase release) and dies. The membrane-residency leader is what shifts the death mode from apoptosis (which the naked p53 peptide drives) to this membrane-pore necrosis.
In support, the group reported selective killing of cancer over untransformed cell lines, pore-like structures by electron microscopy, punctate membrane labeling of the peptide on cancer (but not normal) cells, and detection of HDM-2 in cancer-cell membranes; a 2024 paper from the same lab adds a proposed mitochondrial-membrane disruption component. Two honest caveats frame all of it: this membrane-HDM-2 selectivity model is essentially one group's and has not been independently confirmed, and every finding here is in cell culture or mice — none of it has been demonstrated in a person.
Sources:PMID 20080680PMID 20182728PMID 35625682PMID 38802154
From the studies
Side effects from research
There is no controlled human safety data for PNC-27 of any kind — no clinical trial, no pharmacokinetics, no human toxicology. Its preclinical studies were efficacy experiments in cells and mice, not human safety studies, so nothing about it has been shown to be safe in people.
There is, however, documented human harm tied to its unapproved use. In January 2017 the U.S. Food and Drug Administration issued a public safety alert warning consumers not to use PNC-27: samples being marketed (for nebulized, intravenous, and other use, with claims they could 'treat any cancer') were tested and found bacterially contaminated (Variovorax paradoxus and Ralstonia insidiosa) — an infection risk on top of an unproven product. Separately, a published medical case report describes a patient who developed a massive gastrointestinal hemorrhage from a gastric ulcer and died after transitioning to comfort care while using PNC-27; the authors note that no published human efficacy or safety data exist and frame the link cautiously as a possible complication (causation is not established — it is a single case report, published as a conference abstract).
Beyond that, the general cautions of any non-sterile, unapproved injectable apply — contamination, infection, immune reactions — amplified here by the FDA's specific contamination finding. PNC-27 is not an approved drug anywhere credible; it is sold strictly as 'research use only.' This page reports the research and regulatory record only and makes no therapeutic claim — it does not claim PNC-27 treats, kills, or cures cancer, and it does not provide a way to use it.
As reported in literature
Research dosing ranges
This is the kind of evidence that exists for PNC-27 — laboratory and animal studies only, almost all from one research group, with no independent replication of its anticancer findings. There are no human trials, no human pharmacokinetics, and no human dose. Any animal amounts are research doses given to mice by intraperitoneal injection; they are not human doses and cannot be converted into one.
| Dose | Route | Model | Outcome | Sources: |
|---|---|---|---|---|
| In vitro | Cell culture | Human cancer cell lines (e.g. MIA-PaCa-2 pancreatic, A2058 melanoma) vs untransformed cells | Reported selective necrosis of cancer cells (LDH release) sparing the normal cells tested; binds membrane HDM-2 | PMID 20080680 |
| In vitro | Cell culture | MCF-7 vs MCF-10-2A breast cells | Reported to act as the intact peptide to lyse cells via membrane pores | PMID 20182728 |
| Ex vivo | Patient-derived cells | Patient-derived ovarian cancer cells (ex vivo) | Reported cytotoxicity ex vivo | PMID 26663795 |
| Animal | Intraperitoneal (mice) | Nude-mouse xenografts | In-vivo data for PNC-27 itself are limited; the pivotal animal-efficacy result is for the shorter analog PNC-28 (pancreatic xenografts) — see PNC-28. Mouse doses are not human-transferable | |
| Human | — | None | No human clinical trial, pharmacokinetic, safety, or efficacy data exists. FDA warned against use (2017); a fatal case report exists during unapproved use | FDA safety alert, Jan 2017 |
Quick answers
Frequently asked
Does PNC-27 cure or kill cancer?
There is no evidence it does anything in people. In cell-culture and mouse studies — almost all from one laboratory — researchers reported that it selectively ruptures cancer cells that carry HDM-2 in their membrane. That is a preclinical finding, not a human result. There are no clinical trials and no proof of human benefit, so it cannot be called a cancer treatment.
Are there human clinical trials of PNC-27?
No. A search of ClinicalTrials.gov returns zero registered trials for PNC-27 (and zero for PNC-28). There is no published human efficacy, safety, or pharmacokinetic data.
Is the '500 patients / successful clinical trials' claim true?
It could not be found in any published or registered source, and it is contradicted by the complete absence of registered trials. Treat it as marketing, not fact.
Did the FDA say anything about PNC-27?
Yes. In January 2017 the FDA issued a public safety alert warning people not to use PNC-27, after samples being sold were found contaminated with bacteria (Variovorax paradoxus and Ralstonia insidiosa). It is not an FDA-approved drug.
Has anyone been harmed using it?
A published case report describes a patient who suffered a fatal gastrointestinal hemorrhage while using PNC-27. It is a single case report (a conference abstract), and the authors do not claim PNC-27 caused the bleed — but combined with the FDA's contamination finding, it underscores that this is an unproven, unregulated material.
What is the difference between PNC-27 and PNC-28?
Both share the same membrane-anchoring leader. PNC-27 carries p53 residues 12–26; PNC-28 is shorter (p53 residues 17–26 — essentially PNC-27 minus its first five p53 residues). Both are preclinical-only with the same lack of human data. See the PNC-28 page.
Is there a dose or protocol for PNC-27?
No human dose exists, and this page does not provide one. The only amounts in the literature are research doses given to mice (by intraperitoneal injection); they are not human doses and cannot be converted into one. Given the FDA warning, no self-use guidance is given.
Primary sources
References
- PMID 20080680Sarafraz-Yazdi et al., PNAS 2010;107(5):1918–23 (PNC-27 binds membrane HDM-2; selective cancer-cell necrosis, in vitro)
- PMID 20182728Sookraj et al., Cancer Chemother Pharmacol 2010;66(2):325–31 (acts as the intact peptide to lyse cells via membrane pores)
- PMID 26663795Ann Clin Lab Sci 2015;45(6):650–8 (PNC-27 cytotoxicity in patient-derived ovarian cancer cells, ex vivo)
- PMID 35625682Sarafraz-Yazdi et al., Biomedicines 2022;10(5):945 (membrane-pore/lysis model; primary research from the originating lab, not an independent review)
- PMID 38802154Krzesaj et al., Ann Clin Lab Sci 2024;54(2):137–148 (membrane-HDM-2 + proposed mitochondrial disruption; same lab + Nomocan affiliation)
- FDA safety alert, Jan 2017FDA safety alert (January 2017) — consumers warned not to use PNC-27; sold samples were contaminated with Variovorax paradoxus and Ralstonia insidiosa
- Am J Gastroenterol 2017;112(Suppl 1) (ACG abstract)Case report (conference abstract): 'Experimental PNC-27 Therapy and Massive GI Hemorrhage' — fatal outcome during unapproved use; causation not established
- ClinicalTrials.govClinicalTrials.gov — 0 registered trials for PNC-27 (and 0 for PNC-28), verified 2026-06-03
Reviewed by Ki Researcher Team · Research use only · Not medical advice · Updated 2026-06-04