KiResearcher
PerformanceGRF(1-29)GHRH(1-29)

Sermorelin

Growth-hormone-releasing hormone analog · GRF(1-29)NH₂

Sermorelin is a synthetic 29–amino-acid peptide corresponding to the biologically active 1–29 fragment of human growth-hormone-releasing hormone (GHRH), with a C-terminal amide. It is a secretagogue: rather than supplying growth hormone directly, it binds the GHRH receptor on the anterior pituitary and stimulates the gland to synthesize and release the body's own GH — output that stays subject to normal physiologic feedback. Sermorelin has a real regulatory history: it was an FDA-approved product (Geref) used to diagnose pituitary function and to treat growth-hormone deficiency in children, and it left the US market for commercial rather than safety or efficacy reasons. Today no approved product is marketed; it exists only as a compounded drug, and it is prohibited in sport by WADA.

TL;DRThe whole page · in 30 seconds

GH Secretagogue · Anti-Aging Interest · Body Composition · Sleep & Recovery

The GHRH analog with a real FDA past (it was Geref). Sermorelin raises your own growth hormone instead of injecting it — keeping the natural pulse and feedback in the loop — and adequate nightly dosing lifted GH and IGF-1 within two weeks in older adults, which is why people reach for it for body composition, recovery, and sleep.

The basics

  • A synthetic copy of the active 1–29 fragment of GHRH — the signal your brain uses to tell the pituitary to release GH.
  • A secretagogue, not a hormone: it prompts your own GH rather than supplying it, so normal feedback still applies. Compounded-only today (no approved product).

Why people use it

  • Raises your own GH, doesn't replace it — prompts the pituitary to release the body's own, keeping the natural pulse and feedback control.
  • A gentler, more physiologic signal — its very short action gives a brief pulse rather than a sustained flood, often preferred for older or newer users.
  • Supports IGF-1, body composition, and sleep — adequate nightly dosing in older adults raised nocturnal GH and IGF-1 within two weeks.
  • A real regulatory track record — it was once FDA-approved (Geref) and left the US market for commercial, not safety or efficacy, reasons.

How to run it

  • Dose: 200–500 mcg nightly — start 200–300 mcg, standard range 300–500 mcg
  • How often: Once daily
  • How: Subcutaneous injection; rotate sites
  • When: At bedtime on an empty stomach — rides your biggest natural overnight GH surge; keep ~2 hours clear of food
  • Cycle: 8–12 weeks on, then a 4–8 week washout

Stacks well with

  • Ipamorelin — the cleanest GH-secretagogue duo: sermorelin is the GHRH arm, ipamorelin the selective GHRP arm, for a bigger combined pulse than either alone.
  • BPC-157 — the GH/tissue-repair axis: sermorelin lifts systemic GH/IGF-1 while BPC-157 drives local healing, for soft-tissue injury recovery.

Good to know

  • Empty stomach is the real lever — food raises insulin and free fatty acids, which switch on somatostatin (GH's off-switch) and blunt the pulse.
  • Banned in sport: WADA prohibits GH-releasing factors including sermorelin under S2.2.4, in and out of competition.
  • IGF-1 response is dose-dependent — adequate nightly dosing raised it, but a single low nightly dose didn't move it significantly; pulse cycling (e.g. 5-on/2-off) keeps somatostatin tone down.
Bottom line: The GHRH analog with the most credible history — a gentle, feedback-preserving way to nudge your own GH, run nightly and fasted, banned in sport.
01

Molecular identity

Specs

Molecular weight
3,357.9 g/mol
PubChem CID 16132413
Molecular formula
C149H246N44O42S
PubChem CID 16132413
Monoisotopic mass
3,355.82 Da
PubChem CID 16132413
CAS / UNII
86168-78-7 · 89243S03TE
PubChem CID 16132413
Half-life
~6–7 min (human IV)
Sequence (29 AA)
YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH₂PubChem CID 16132413
Structure / class
Synthetic GHRH(1-29) amide (GRF 1-29 NH₂)GEREF SPC
Molecular target
GHRH receptor (GHRHR) on pituitary somatotrophsPMID 18031173
Regulatory status
Formerly FDA-approved (Geref); now compounded-only · WADA S2.2.4 prohibitedFDA / research literature
02

Plain English

Mechanism

Sermorelin is a growth-hormone-releasing hormone (GHRH) receptor agonist — a molecule that switches on a receptor the way the body's own hormone would. It binds the GHRH receptor on anterior-pituitary somatotrophs (the growth-hormone-making cells of the front lobe of the pituitary, the master gland beneath the brain) and stimulates the synthesis and pulsatile (released in bursts) release of endogenous (the body's own) growth hormone. The 1–29 fragment — the first 29 building blocks of the natural 44-block hormone — retains the full GH-releasing potency of the native hormone, which is why the short analog is used.

Because sermorelin acts upstream — prompting the patient's own GH (growth hormone) rather than supplying it exogenously (from outside the body) — the response remains under normal physiologic negative feedback (the body's built-in braking system that dials a hormone down when there is enough). Somatostatin tone (the level of the body's natural GH-suppressing signal) and IGF-1 feedback still gate the output, and the GEREF labeling documents this indirectly: untreated hypothyroidism (an underactive thyroid gland), elevated somatostatin, obesity, hyperglycemia (high blood sugar), and high free fatty acids (fats circulating in the blood) all blunt the GH response to sermorelin. This feedback-preserving behavior is the basis for the common framing of sermorelin as supporting pulsatile, physiologic secretion rather than delivering a fixed dose from outside.

Downstream, the released GH drives hepatic (liver) production of IGF-1 — insulin-like growth factor 1, the messenger through which much of growth hormone's effect is actually carried out. In age-advanced adults, nightly GHRH(1-29) raised nocturnal (nighttime) GH and increased serum (blood) IGF-1 and IGFBP-3 (a carrier protein that ferries IGF-1 in the blood) within two weeks — but the IGF-1 response is regimen-dependent (it changes with the dosing pattern): a single low nightly dose in elderly men raised nocturnal GH without a significant IGF-1 rise. So the claim that sermorelin reliably raises IGF-1 holds only for adequate dosing regimens.

Sources:GEREF SPC (HPRA)PMID 18031173PMID 9141536PMID 9005976

03

Why people reach for it

Potential benefits

Sermorelin is the GHRH analog with a real FDA pedigree — here's what draws people to it.

  • Raise your own growth hormone, not inject itIts core appeal. Rather than supplying GH from outside, it prompts the pituitary to make and release the body's own — keeping the natural pulse and feedback control in the loop.
  • A gentler, more physiologic GH signalIts very short action produces a brief, pulse-shaped GH release rather than a sustained flood — which is why practitioners often prefer it for a milder, more natural-feeling profile, especially in older or newer users.
  • Supports IGF-1, body composition, and sleepAdequate nightly dosing in older adults raised nocturnal GH and IGF-1 within two weeks — the basis for the body-composition, recovery, and sleep-quality goals people reach for it for.
  • A real regulatory history behind itUnusually for this category, it was once an FDA-approved drug (Geref) and left the US market for commercial — not safety or efficacy — reasons, so it carries a documented human track record.
  • The classic bedtime partner for a clean GHRPIt pairs with a ghrelin-receptor peptide for a bigger combined pulse than either alone — most cleanly with Ipamorelin, the GHRH arm plus the selective GHRP arm.

Sources:GEREF SPC (HPRA)PMID 18031173PMID 9141536PMID 9005976

What people reach for Sermorelin for, drawn from what the research reports (its controlled human evidence is mostly pediatric and diagnostic) and how it's used — not proven adult anti-aging outcomes or medical claims.

04

Implied timing

Best time to dose

Implied best time

Bedtime (empty stomach)

Most people inject Sermorelin at bedtime on an empty stomach, lining the pulse up with the body's largest natural GH surge.

  • Sermorelin amplifies the body's own GH release, and the single largest natural GH pulse fires in early slow-wave (deep) sleep (~60–90 min after falling asleep) — a bedtime dose stacks the peptide's signal on top of that nocturnal surge. The older-adult studies dosed around 21:00 for exactly this reason.
  • Food is the reason for the empty stomach: insulin (raised by carbs) and free fatty acids (raised by dietary fat) both activate somatostatin (GH's off-switch) and measurably blunt the response — the GEREF label documents this. Allow ~2 hours clear of the last meal.
  • Its action is very short (~6–7 min IV half-life, GH peaking around 30 min), so the brief pulse is most useful placed right as the overnight recovery window opens.
  • A consistent nightly time matters more than the exact hour; bedtime is the practical anchor most protocols settle on.

No study establishes an ideal time of day for Sermorelin — this is reasoned from its GHRH mechanism and how it's used. As a rule of thumb peptide dosing lands in the midday-to-evening window; for Sermorelin the lean is bedtime, fasted.

Sources:GEREF SPC (HPRA)PMID 9141536

05

How to run it

Dosing & protocol

Sermorelin is injected subcutaneously — a shallow injection into the fat just under the skin — typically once daily at bedtime. Because it is a secretagogue (a signal, not the hormone itself), timing matters more than with direct GH: inject on an empty stomach so that circulating insulin and somatostatin don't blunt the pulse you're trying to trigger. The numbers below are community and practitioner convention extrapolated from the small older-adult studies cited in the research table — not a controlled-trial adult wellness dose.

Practitioner/community convention, not a trial-proven adult wellness dose. Sermorelin's controlled human evidence is in pediatric GH deficiency and diagnostic testing; the adult wellness figures are extrapolated from small (n≈11–19, ≤16 wk) pharmacodynamic studies. It is compounded-only (no current FDA-approved product) and banned in sport (WADA S2.2.4). Every number here is a usage pattern, not evidence.

Tiered dose ranges

Most adult wellness protocols settle between 200–500 mcg nightly SC; higher ranges come from the older-adult studies.

Low / introductory:
200–300 mcg once daily at bedtime — the starting range to assess tolerance and sleep response. The Vittone 1997 study used 2 mg nightly in elderly men; 200–300 mcg is the lower end practitioners start with for younger adults.
Standard:
300–500 mcg once daily at bedtime — the mainstream community convention for ongoing adult wellness goals (body composition, recovery, sleep quality).
Upper range (less common):
Some practitioners use up to ~500 mcg; doses above this increase pituitary stimulation without proportional GH gain once the receptor is saturated — and the longer you dose continuously, the more somatostatin tone rises to brake the pulse.

Subcutaneous administration

Site, timing, and the food window are the three variables that most affect the GH response.

Injection site:
Lower abdomen (staying 2 inches / ~5 cm clear of the navel), the love-handle area, or the outer thigh. Rotate sites between doses to prevent local irritation and lipohypertrophy (fatty lumps from repeated injection into the same spot).
Timing (key insight):
Inject at bedtime on a fully empty stomach — the body's largest natural GH surge occurs during early slow-wave sleep (~60–90 min after falling asleep). The older-adult studies dosed at ~21:00 for this reason. Allow at least 2 hours after the last carbohydrate- or fat-containing meal: insulin (raised by carbs) and elevated free fatty acids (raised by dietary fat) both activate somatostatin — the GH 'off-switch' — and measurably blunt the GH response to sermorelin. The GEREF label documents this explicitly.
Measuring the dose:
Drawn on a U-100 insulin syringe from the reconstituted vial. Using the calculator defaults (5 mg vial + 2 mL BAC water = 2,500 mcg/mL, 25 mcg/IU): 200 mcg = 8 IU · 300 mcg = 12 IU · 400 mcg = 16 IU · 500 mcg = 20 IU. Adjust if you use a different dilution — the on-page calculator does the math live.
Food window:
No carbohydrates or fat for ~2 hours before the injection (protein-only or fasted is fine). Water and unflavored electrolytes are acceptable. This is the single most actionable thing you can do to preserve the GH pulse.

Cycle & washout

Secretagogues are generally pulsed rather than run indefinitely; continuous stimulation raises somatostatin tone over time, attenuating the response.

Standard cycle:
8–12 weeks of daily nightly dosing, then reassess. The older-adult study ran 16 weeks; practitioner convention is often 8–12 weeks for a first cycle to gauge the IGF-1 and body-composition response.
Washout:
4–8 week break between cycles. Check fasting IGF-1 (target: mid-normal for age) during the washout to see whether baseline has shifted. Somatostatin tone normalises within a few weeks off.
Pulsatile option:
Some practitioners run 5 days on / 2 days off (the weekend off) rather than daily continuous dosing, on the theory that two unblocked days per week lower somatostatin tone and preserve receptor sensitivity — not trial-proven, but consistent with the biology.

Reconstitution at a glance

The on-page calculator does this live; the quick reference for a 5 mg vial (the calculator default):

Mixing:
5 mg vial + 2 mL bacteriostatic water = 2,500 mcg per mL. On a 100-unit (1 mL) insulin syringe: 250 mcg = 10 IU · 300 mcg = 12 IU · 400 mcg = 16 IU · 500 mcg = 20 IU.

Sources:GEREF SPC (HPRA)PMID 9141536PMID 9005976

06

Substrate the signal needs

Nutritional cofactor precision

Sermorelin works by triggering a GH pulse through the GHRH receptor. How large that pulse is depends heavily on what is inhibiting it — somatostatin (the GH off-switch), insulin, and free fatty acids are all documented pulse-blunters on the GEREF label. The useful cofactors either relieve those brakes, offset the downstream metabolic cost of chronically elevated GH, or supply the substrate the GH/IGF-1 system actually builds with.

Reasoned from GHRH-axis physiology plus the GEREF label's documented GH-response blunters — not a sermorelin cofactor study. Supplement doses are common community/practitioner ranges. None of this is specific to sermorelin trials.

Amplify the pulse — relieve the somatostatin brake

Somatostatin is GH's off-switch; several nutrients lower it or directly amplify the GHRH signal.

L-arginine:
3–6 g taken ~30 min before the injection. Sermorelin's own GEREF diagnostic protocol pairs GHRH with IV arginine because arginine lowers somatostatin tone — the same mechanism works orally at these doses. Citrulline malate (3–6 g) is an alternative with better gut tolerance (it converts to arginine in the kidney).
Glycine:
3–10 g before bed. Glycine is a mild GH secretagogue in its own right and also promotes slow-wave (deep) sleep — the stage during which the natural nocturnal GH surge occurs and where a bedtime dose of sermorelin lands. Doubling as a sleep-quality cofactor makes this the single most useful bedtime addition.
Alpha-GPC:
300–600 mg taken ~30 min before injection. Alpha-GPC (L-alpha-glycerylphosphorylcholine) acutely raises GH output by inhibiting somatostatin at the pituitary level. The 600 mg dose is the better-studied acute GH-augmenting dose; 300 mg is a reasonable starting point.

Mitigate the cost — offset GH-driven metabolic pressure

GH chronically raises fasting glucose and mildly lowers insulin sensitivity — manageable at physiologic doses but worth tracking.

Berberine:
500 mg twice daily with meals. Berberine activates AMPK, improves insulin sensitivity, and lowers fasting glucose — a direct offset for the insulin-desensitizing pressure GH applies. Particularly useful on longer cycles (>8 weeks) or in anyone with borderline fasting glucose.
Alpha-lipoic acid (ALA):
600 mg daily with the largest meal. ALA improves peripheral insulin sensitivity and has a mild glucose-lowering effect. Pairs well with berberine without stacking the same mechanism.
Magnesium glycinate or threonate:
300–400 mg elemental magnesium before bed. Supports insulin sensitivity, promotes deep sleep (amplifying the nocturnal GH surge sermorelin rides), and is commonly depleted in active individuals. Threonate has better CNS penetration if sleep quality is the primary goal.

Supply the substrate — feed the GH/IGF-1 system

The point of the GH rise is IGF-1-driven protein synthesis; without raw material, the signal has nothing to build with.

Protein intake:
1.6–2.0 g per kg of body weight per day (~0.7–0.9 g per pound). Leucine is the key amino acid trigger for muscle protein synthesis downstream of IGF-1 — ensure meals contain ≥2.5–3 g leucine (roughly 30–40 g high-quality protein per meal). Whey, eggs, and meat are reliable sources.
ZMA (zinc + magnesium + B6) before bed:
Zinc 30 mg + magnesium 450 mg + B6 10.5 mg (standard ZMA dose), taken 30–60 min before the bedtime injection on an empty stomach. Zinc tracks closely with IGF-1 — low zinc tends to suppress the IGF-1 response to GH stimulation. This also overlaps with the magnesium sleep benefit above (choose one or the other, not both, to avoid excess magnesium).
Vitamin D3:
2,000–5,000 IU daily, dosed to a serum 25(OH)D in the sufficient range (40–60 ng/mL). Vitamin D regulates the GH/IGF-1 axis and musculoskeletal tissue function; deficiency blunts many anabolic pathways the GH pulse feeds.

Sources:GEREF SPC (HPRA)PMID 18031173

07

Combinations + timing

Stacking notes + timing windows

Sermorelin occupies the GHRH-receptor arm of the classic GH-secretagogue stack. The synergistic pairing is a GHRH analog plus a GHRP (a ghrelin-receptor agonist) — two different receptors on the same pituitary cell, producing a pulse larger than either alone. Pairing sermorelin with another GHRH analog (CJC-1295, Tesamorelin) pushes the same receptor twice — redundant, not additive — and should be avoided.

Practitioner convention reasoned from receptor biology — no primary trial of sermorelin in combination has been located. All of sermorelin's controlled human evidence is as a single agent (pediatric GHD + diagnostic). Stack doses are community convention; 'commonly combined for' describes where users reach, not a proven indication. WADA S2.2.4 applies to all partners here.

Sermorelin + Ipamorelin

The cleanest GH-secretagogue stack — the GHRH arm (sermorelin) plus the selective GHRP arm (ipamorelin).

Why it works:
Ipamorelin agonises the ghrelin/GHS-R1a receptor on pituitary somatotrophs — a completely separate receptor from the GHRH receptor sermorelin activates. The two signals converge on the same GH release machinery, producing a synergistic pulse that is larger than either alone. Ipamorelin is the preferred GHRP partner because it is highly selective: it raises GH without meaningfully raising cortisol, prolactin, or ACTH at standard doses — a key advantage over GHRP-2 and GHRP-6.
The protocol:
Sermorelin 200–300 mcg + Ipamorelin 200–300 mcg, co-injected subcutaneously once daily at bedtime on an empty stomach (~2-hour food window). Drawn into the same syringe from the respective reconstituted vials. Some practitioners run ipamorelin twice daily (morning + bedtime) while sermorelin stays once nightly; the morning ipamorelin-only dose rides a secondary GH window without the full GHRH stack.
Outcome:
The most common wellness-use sermorelin stack — commonly combined for body-composition support, sleep quality, and recovery goals. Sermorelin supplies the pulsatile feedback-preserving GHRH signal; ipamorelin adds amplitude without the cortisol/hunger side-effects of other GHRPs.

Sermorelin + GHRP-2

A higher-amplitude GHRP alternative when a stronger GH pulse is the goal — more side-effect trade-off than ipamorelin.

Why it works:
GHRP-2 is a potent ghrelin-receptor agonist that produces a larger GH pulse than ipamorelin but also meaningfully raises cortisol and prolactin at standard doses, and increases appetite more substantially. Same receptor complementarity with sermorelin as the ipamorelin pairing — different risk/benefit balance. Choose GHRP-2 over ipamorelin only when maximizing acute GH amplitude is the explicit goal (e.g. accelerating recovery from injury) and the cortisol/appetite side-effects are acceptable.
The protocol:
Sermorelin 200–300 mcg + GHRP-2 100–200 mcg, co-injected subcutaneously once daily at bedtime on an empty stomach. GHRP-2 dose is typically kept at 100 mcg to limit the cortisol/appetite response; 200 mcg is the upper community convention dose.
Outcome:
Commonly combined for acute recovery acceleration (injury, post-surgical) where maximal GH amplitude is prioritized. Not the first-choice stack for general wellness or long cycles because of the cortisol/appetite cost.

Sermorelin + BPC-157

The GH/tissue-repair axis — adds a direct healing signal to the pulsatile GH stimulation.

Why it works:
BPC-157 promotes angiogenesis (new blood vessel growth) and structural repair in tendons, ligaments, and gut tissue through a non-GH pathway. Sermorelin raises systemic GH/IGF-1, which accelerates protein synthesis and tissue remodelling broadly. The two compounds work at different levels — local structural repair vs systemic anabolic signal — so they are complementary rather than redundant. GH also enhances collagen cross-linking; BPC-157 drives the vascular scaffolding that lets repaired tissue survive.
The protocol:
Sermorelin 200–300 mcg SC at bedtime (as above) + BPC-157 250–500 mcg SC once daily (typically morning or around training / injury site). The two injections are usually given at separate times of day — no reason to co-inject, and spacing them lets each ride its own timing window.
Outcome:
Commonly combined for soft-tissue injury recovery — tendon, ligament, muscle strain, or post-surgical healing where both the systemic anabolic environment (sermorelin) and local repair signal (BPC-157) are wanted simultaneously. Not a redundant stack — different levers.

Sources:GEREF SPC (HPRA)PMID 9141536

08

Reconstitution math

Reconstitution calculator

Reconstitution calculator

Calculated for a 1 mL U-100 insulin syringe (100 units/mL).

mg
mL

Units per dose

12

Draw to this mark on a U-100 syringe

Volume per dose
0.12 mL
Doses per vial
16
Concentration
2.5 mg/mL

One vial lasts

Daily
16 days
Every other day
33 days
5×/week
23 days

Research use only. Not for human consumption. Outputs are reference values based on research literature — verify all measurements independently.

09

From the studies

Side effects from research

In the pediatric (childhood) treatment and diagnostic literature, sermorelin was generally well tolerated. The most common reactions were at the injection site — pain, swelling, and redness — reported in roughly one in six patients in one monograph. Facial flushing (a warm reddening of the face) and a sensation of facial heat occurred occasionally and usually resolved within minutes.

With intravenous (into-a-vein) diagnostic use, additional reported reactions include taste disturbance (dysgeusia — a distorted sense of taste), headache, nausea, vomiting, pallor (paleness), and chest tightness. Rarer reports include dizziness, hyperactivity, somnolence (drowsiness), urticaria (hives — an itchy raised rash), and isolated allergic reactions. The older-adult study noted transient (temporary) hyperlipidemia (raised blood fats) that resolved.

The label contraindicates (rules out) use in known hypersensitivity (allergy) to sermorelin or excipients (the inactive ingredients in the formulation) and in pregnancy and lactation (breastfeeding). In preclinical (pre-human, animal) toxicity studies the peptide was well tolerated up to 100× the recommended human dose.

Sources:RxList (secondary)GEREF SPC (HPRA)PMID 18031173PMID 9141536

10

As reported in literature

Research dosing ranges

These are the doses actually used in the published studies — the evidence the practical figures above lean on, shown separately so research data is never mistaken for a settled adult dose. Sermorelin's human data spans three distinct contexts: single-dose diagnostic testing of pituitary function (µg/kg IV — micrograms per kilogram of body weight, given intravenously, into a vein), chronic treatment of childhood growth-hormone deficiency (the indication of the former Geref product), and a small set of short older-adult research studies often cited for 'anti-aging.' The latter establish GH/IGF-1 (growth-hormone and its downstream messenger IGF-1) pharmacodynamics — how the drug acts on the body — in older adults, not clinical anti-aging, fat-loss, or longevity outcomes, and one used a related analog rather than sermorelin itself. Doses below are as reported in the label and literature.

DoseRouteModelOutcomeSources:
1.0 µg/kg (single)IVHuman (pituitary-function test)Provokes GH peak ~30 min; diagnostic test for GH deficiencyGEREF SPC (HPRA)
1 µg/kg + arginineIVHuman (suspected GHD)GHRH+arginine test more specific than GHRH alonePMID 18031173
30 µg/kg nightlySCChildren (idiopathic GHD)Sustained increase in height velocity; catch-up growth in most, but less than somatropinPMID 18031173
GRF(1-29) twice dailySCChildren (n=18, GH-deficient)12/18 increased height velocity over 6–18 moPMID 2879138
Continuous infusion, 6 moSCChildren (n=6, partial GHD)Mixed: growth response in 3/6; GH output declined over 6 moPMID 8329829
10 µg/kg nightly (21:00), 16 wkSCHealthy older adults (n=19, 55–71) — [Nle²⁷] analog↑ nocturnal GH, ↑ IGF-1 & IGFBP-3 by 2 wk; sex-dependent lean-mass / libido changes; transient hyperlipidemiaPMID 9141536
2 mg nightly, 6 wkSCHealthy elderly men (n=11, 64–76)↑ nocturnal GH; no significant IGF-1 change; single nightly dose less effective than multiple dailyPMID 9005976
11

Quick answers

Frequently asked

Is sermorelin FDA-approved?

It was — marketed as Geref for diagnosing pituitary function and treating growth-hormone deficiency in children. The approved product is no longer marketed; the FDA determined in 2013 that it was withdrawn for commercial, not safety or efficacy, reasons. Today sermorelin exists only as a compounded drug, which is not the same as FDA-approved.

How is sermorelin different from HGH?

Sermorelin is a secretagogue: it stimulates your own pituitary to release growth hormone, which stays under normal feedback control. Somatropin (HGH) is exogenous growth hormone given directly. In children, sermorelin produced real height-velocity gains, but less than somatropin.

Is sermorelin banned in sport?

Yes. WADA prohibits growth-hormone-releasing factors, including sermorelin, under Section S2.2.4 of the Prohibited List — banned at all times, in and out of competition.

What is sermorelin's half-life?

Very short — about 6–7 minutes after intravenous dosing per the label (some monographs cite 11–12 minutes). The growth-hormone response peaks around 30 minutes and lasts two to three hours.

Does sermorelin reliably raise IGF-1?

It depends on the regimen. Adequate nightly subcutaneous dosing in older adults raised IGF-1 within two weeks, but a single low nightly dose did not produce a significant IGF-1 increase.

Is there real anti-aging evidence for sermorelin?

Only small, short studies (n≈11–19, ≤16 weeks) in healthy older adults showing short-term GH/IGF-1 pharmacodynamics and some sex-dependent body-composition and libido changes — and one used a related analog rather than sermorelin itself. These do not demonstrate clinical anti-aging, fat-loss, or longevity outcomes.

12

Primary sources

References

  • PubChem CID 16132413PubChem — Sermorelin (CID 16132413)
  • GEREF SPC (HPRA)GEREF 50 Summary of Product Characteristics (Serono, HPRA)
  • Fed. Reg. 2013-04827FDA Federal Register, 4 Mar 2013 — GEREF not withdrawn for safety/effectiveness
  • PMID 18031173Prakash & Goa 1999 — Sermorelin: review of use in childhood GH deficiency
  • PMID 2879138Ross et al. 1987 — GHRH treatment of GH deficiency (Lancet)
  • PMID 9141536Khorram, Laughlin & Yen 1997 — long-term [Nle27]GHRH(1-29) in age-advanced adults
  • PMID 9005976Vittone et al. 1997 — single nightly GHRH(1-29) in healthy elderly men
  • PMID 8329829Tauber et al. 1993 — continuous SC GHRH(1-29) in partial GHD
  • WADA Prohibited List S2.2.4WADA Prohibited List — S2.2.4 Growth Hormone-Releasing Factors
  • RxList (secondary)RxList monograph — Sermorelin acetate (label-derived PK)

Reviewed by Ki Researcher Team · Research use only · Not medical advice · Updated 2026-06-01