IGF-1 DES
des(1-3) Insulin-like Growth Factor 1 · 67-AA truncated IGF-1
IGF-1 DES is a naturally-occurring, more-potent fragment of IGF-1: native IGF-1 with its first three amino acids (Gly-Pro-Glu) removed, leaving 67 residues. Losing that tip abolishes its grip on the IGF-binding proteins, which makes it roughly ten times stronger than native IGF-1 in cell and animal studies — but because it has no binding-protein reservoir to hold it, it is short-acting, the opposite design philosophy from the long-acting IGF-1 LR3. It is the most potent IGF variant at lowering blood sugar. It is a research reagent with no approved human use, no human trials, and is prohibited in sport (WADA).
TL;DRThe whole page · in 30 seconds
Site-Targeted · Ultra-Potent · Short-Acting · Local Muscle
The short, strong member of the IGF family. By dropping IGF-1's first three amino acids, DES barely binds the carrier proteins — making it roughly ten times more potent than native IGF-1 in cell and animal studies, fired as a brief, local muscle-building pulse injected right into the trained muscle. The trade-off: with no reservoir to hold it, it's short-acting.
The basics
- A naturally-occurring truncated IGF-1 (native IGF-1 minus Gly-Pro-Glu, leaving 67 residues).
- Banned in tested sport (WADA) — matters if you compete.
Why people use it
- Potent local pulse — hits the IGF-1 receptor harder than native IGF-1, roughly 10× more potent in cells and GH-deficient mice, firing PI3K–Akt protein synthesis where it's injected.
- Built for site-specific work — with no binding-protein reservoir to carry it around the body, it stays brief and concentrates the growth signal in one worked muscle.
- Timed to the training window — injected peri-workout, it lands while the muscle is vasodilated and IGF-1R expression is elevated.
- The strong-but-brief complement — the natural partner to a long-acting systemic signal, most commonly IGF-1 LR3 holding the all-day base.
How to run it
- Dose: 50 mcg (introduction) → 75–100 mcg standard → 100–150 mcg high, per session. Risk scales with dose.
- How often: Once per training session, training days only (typically 3–5×/week) — short-acting, no benefit on rest days.
- How: Subcutaneous, into or adjacent to the worked muscle; rotate sites within the same muscle.
- When: Peri-workout — within 15–30 min of finishing training (some inject 15–20 min pre).
- Cycle: 4–6 weeks on, 4–6 weeks off.
Stacks well with
- IGF-1 LR3 — the classic division of labor: LR3 holds the systemic all-day base while DES delivers the targeted local pulse.
- MGF / PEG-MGF — satellite-cell activation in the same post-workout window; MGF opens the door, DES builds through it.
Good to know
- Hypoglycemia is the sharpest risk in the IGF family — DES is the most potent glucose-lowering IGF variant. Never inject fasted; keep fast carbohydrates on hand.
- The insulin + DES combination is a documented dangerous practice — it compounds the glucose drop unpredictably. Known risk, not endorsed.
- Prohibited in sport (WADA S2). Short-acting — its effect is brief, so the whole rationale is a tight peri-workout window.
Molecular identity
Specs
- Molecular weight
- 7,371.48 g/mol
- Molecular formula
- C319H501N91O96S7
- CAS / UNII
- 112603-35-7 · AG0WVP88OA
- Sequence (67 AA)
- TLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSAUniProt P05019 (mature IGF-1 minus Gly-Pro-Glu)
- Structure / class
- Truncated IGF-1: native mature IGF-1 (70 AA) lacking the N-terminal tripeptide Gly-Pro-GluUniProt P05019
- Physical form
- Lyophilized powder (recombinant); naturally occurring IGF-1 variant in brain, colostrum, uterine tissueResearch literature
- Molecular target
- IGF-1 receptor (IGF-1R) agonist; negligible IGFBP binding (IGFBPs do not inhibit it)PMID 2539101
- Half-life
- Not established (short-acting; no human PK study)Not established
- Regulatory status
- Research reagent; not FDA-approved; prohibited in sport (WADA S2.3, IGF-1 analogues)WADA Prohibited List
Plain English
Mechanism
Like native IGF-1, DES works by switching on the IGF-1 receptor (IGF-1R), which fires the PI3K–Akt pathway (build protein, survive — the anabolic side) and the MAPK pathway (divide and multiply — proliferation). Akt activation by DES has been confirmed in living tissue, not just in dishes.
What makes DES different is the missing N-terminal tip. Native IGF-1 is normally tied up by six carrier proteins, the IGF-binding proteins (IGFBPs). The single most important change in DES is the loss of the glutamate at position 3 — that residue is what lets IGF-1 bind those carriers, and removing it means the binding proteins essentially cannot inhibit DES at all. With no carrier sponge soaking it up, far more DES is free to hit the receptor, which is why it is roughly ten times more potent than native IGF-1 in cells and in growth-hormone-deficient mice.
The same carrier-escape also makes DES the most potent IGF variant at lowering blood sugar — in pigs and monkeys it produced a stronger and longer hypoglycemic (low-blood-sugar) effect than native IGF-1. That is the mechanism behind its main acute danger.
Sources:PMID 8930132PMID 2539101PMID 2280209PMID 9415072PMID 12745670
Why people reach for it
Potential benefits
IGF-1 DES is the short, strong, site-targeted member of the IGF family — the one people inject into the muscle they're training for a local hit. Here's what draws them to it.
- A potent local muscle-building pulse — Its headline appeal. DES hits the IGF-1 receptor harder than native IGF-1 — roughly ten times more potent in cells and in growth-hormone-deficient mice — firing PI3K–Akt protein synthesis right where it's injected.
- Built for site-specific work — Its short action is the point: with no binding-protein reservoir to carry it around the body, it stays brief and is used to concentrate the growth signal in one worked muscle rather than spread it thin.
- Timed to the training window — Injected peri-workout, it lands while the muscle is still vasodilated and IGF-1R expression is elevated — which is exactly why people tie it to the session instead of the clock.
- The strong-but-brief complement to a long base — It's the natural partner to a systemic, long-acting signal — most commonly IGF-1 LR3, which holds the all-day background while DES delivers the targeted pulse.
- Pairs with a satellite-cell primer — Reached for alongside MGF in the same post-workout window — MGF proposed to wake satellite cells, DES to drive the proliferation signal once they're active.
Sources:PMID 8930132PMID 2280209PMID 2539101PMID 12745670
What people reach for IGF-1 DES for, drawn from what the research reports (cell and animal studies — no human trials) and how it's used — not proven human outcomes or medical claims.
Implied timing
Best time to dose
Implied best time
Around training (local)
Most people inject IGF-1 DES into the worked muscle right around training — within about 15–30 minutes of the session — for a brief, local growth pulse.
- DES is potent but short-acting (no IGFBP reservoir holds it in circulation), so the whole rationale is to fire it exactly when the target muscle is receptive — peri-workout, while it's vasodilated and IGF-1R expression is elevated — not at a fixed hour.
- Because the effect is local and brief, the injection site and its timing to the session are the defining choices: dose into or beside the muscle you just trained, on training days only. There's no benefit to a rest-day dose in this local-growth convention.
- Some users inject 15–20 minutes pre-workout instead; peri-workout post-training is the more common convention. Either way, timing is set by the workout, not the clock.
- A safety caution overrides any timing preference: DES is the most potent glucose-lowering IGF variant, so it's always dosed with a carbohydrate-containing meal in the same window and never injected fasted.
No study establishes an ideal time of day for IGF-1 DES — this is reasoned from its short half-life and how it's actually used. Most peptide dosing lands in the midday-to-evening window; for DES the anchor is the training session rather than the time of day.
Sources:PMID 2539101PMID 9415072
How to run it
Dosing & protocol
DES is site-injected into the trained muscle immediately around the workout window — the convention is a strong, brief, local pulse of IGF-1R signaling delivered exactly when the target muscle is receptive. The calculator and U-100 syringe examples below assume a 1 mg vial + 1 mL bacteriostatic water (1,000 mcg/mL). No human trial has set a dose; everything here is community and practitioner convention extrapolated from animal pharmacology.
Community convention only — IGF-1 DES has no human clinical trial and no approved human dose. Hypoglycemia risk is the sharpest in the IGF family: never inject fasted, always have fast-acting carbohydrates on hand. WADA S2 prohibited substance.
Tiered dose ranges
Most protocols scale the dose to the user's body weight, training intensity, and tolerance established on a lower starting dose.
- Low / introduction:
- 50 mcg per session — used first when testing tolerance; injected into the worked muscle within 15 minutes of finishing training.
- Standard:
- 75–100 mcg per session — the most common working dose in community practice. Injected into the target muscle peri-workout (immediately before or within 15 minutes after).
- High:
- 100–150 mcg per session — upper end of community-documented use; not a ceiling from any study. Hypoglycemia risk scales with dose; fast carbohydrates are essential at this range.
- Frequency:
- Once per training session, on training days only. DES is short-acting; there is no benefit to dosing on rest days in the local-growth convention.
Subcutaneous administration
DES is injected subcutaneously into or adjacent to the muscle being trained — the short half-life limits how far the active peptide can travel, making site selection the defining technique choice.
- Injection site:
- Inject directly into the subcutaneous fat overlying the worked muscle — e.g. lateral quad for leg day, lateral deltoid for shoulder day. Use a different site within the same muscle each session to avoid local irritation.
- Timing:
- Peri-workout: within 15–30 minutes of finishing training, while the muscle is still vasodilated and IGF-1R expression is elevated — see Best time to dose above. Some users inject 15–20 minutes pre-workout; peri-workout post-training is the more common convention.
- Measuring the dose:
- On a U-100 insulin syringe from a 1 mg/mL vial (1 mg + 1 mL BAC water): 50 mcg = 5 IU · 75 mcg = 7.5 IU · 100 mcg = 10 IU · 150 mcg = 15 IU. The on-page calculator resolves any vial dilution.
- Food window:
- Do not inject fasted. Eat a mixed meal or carbohydrate-containing pre/post-workout within 30 minutes of the dose. DES is the most potent glucose-lowering IGF variant — the food window is a safety rule, not a preference.
Cycle & washout
Short cycles are the norm for DES — both to limit sustained IGF-1R stimulation and because community practice treats it as a focused local-growth tool, not a chronic background compound.
- Standard cycle:
- 4–6 weeks on, used on training days only (typically 3–5 doses per week). Longer use has no human outcome data and extends theoretical receptor-desensitization and pro-proliferative exposure.
- Washout:
- 4–6 weeks off between cycles. During the washout, any co-run compounds (e.g. IGF-1 LR3) are typically stopped simultaneously.
- Honest frame:
- The 'localized growth' rationale is mechanistically plausible (short IGFBP-escape limits spread) but has never been demonstrated in a human trial. The cycle structure is convention, not evidence.
Reconstitution at a glance
The on-page calculator handles any vial size; the quick reference for the standard 1 mg vial used in the examples above:
- Mixing:
- 1 mg vial + 1 mL bacteriostatic water = 1,000 mcg per mL. On a 100-unit (1 mL) insulin syringe: 50 mcg = 5 IU · 100 mcg = 10 IU · 150 mcg = 15 IU.
- Why 1 mL:
- The 1:1 dilution gives clean, round syringe units across the 50–150 mcg dose range — no fractional measurements at the low end.
Substrate the signal needs
Nutritional cofactor precision
DES drives local protein synthesis through IGF-1R → PI3K–Akt in the target muscle. The cofactors do three jobs: supply the raw material Akt builds with, mitigate the sharpest hypoglycemia risk in the IGF family, and amplify the local signal by making the target muscle as receptive as possible.
Reasoned from IGF-1 physiology and the glucose-lowering mechanism confirmed in animal studies — not a DES-specific cofactor study. Supplement and nutrition doses are practical convention.
Supply the substrate — protein + leucine
DES drives mTOR-mediated protein synthesis; the amino acid leucine is the co-trigger. Without adequate protein on board, the receptor signal has nothing to build.
- Protein target:
- 1.8–2.2 g per kg of body weight per day (roughly 0.8–1.0 g per pound), with a caloric surplus — IGF-1R signals anabolism, not catabolism. The peri-workout meal or shake carrying carbohydrates (see below) should also include 30–50 g of high-leucine protein (whey, eggs, or a leucine-spiked blend).
- Leucine pulse:
- 3–5 g free-form leucine in the peri-workout window (the same window as the injection) maximally activates mTOR alongside the DES signal. A leucine-rich protein source counts; supplemental leucine adds precision.
- Timing:
- Pre- or immediately post-workout — the same 15–30-minute window as the injection. Co-delivery of the anabolic signal and the substrate is the point.
Mitigate hypoglycemia — carbohydrates + glucose awareness
DES is the most potent IGF variant at lowering blood glucose, confirmed in pigs and primates. This is the non-negotiable safety cofactor — not optional and not deferrable.
- Carbohydrate with the dose:
- 30–60 g of fast-acting carbohydrates in the peri-workout meal or shake taken within 30 minutes of the injection. Rice, oats, banana, dextrose — any readily absorbed source. Never inject into a fasted state.
- Fast carbs on hand:
- Keep glucose tablets, juice, or a sugary snack within reach during and for 60–90 minutes after the injection. Hypoglycemia from a short-acting, high-potency IGF variant can develop faster than expected.
- Glucose awareness:
- Learn the symptoms of hypoglycemia: lightheadedness, shakiness, cold sweat, rapid heartbeat, sudden hunger. If they appear, consume fast carbohydrates immediately and do not inject again until the cause is understood. Consider a continuous glucose monitor (CGM) during the first cycle for objective data.
- Avoid insulin stacking:
- The insulin + DES combination is a documented dangerous practice in the user community. DES already delivers the sharpest glucose drop in the IGF family; adding exogenous insulin compounds the effect unpredictably. This combination is described as a known risk, not endorsed.
Amplify — train the target muscle
The local-growth convention is built on one insight: the trained muscle is the target. Mechanical work elevates IGF-1R expression and glucose uptake in the exercised tissue, making it maximally receptive to the DES pulse.
- Train first, inject into that muscle:
- The convention is deliberate: resistance-train the muscle you intend to inject, then inject into it within the peri-workout window. Skipping training and injecting anyway removes the primary amplifier.
- Progressive overload:
- Adequate training stimulus (progressive mechanical overload, not just movement) is what elevates local IGF-1R and nutrient uptake. A light session produces a weaker receptor environment for the DES pulse.
- Zinc + magnesium:
- Zinc (15–30 mg zinc picolinate or bisglycinate daily) and magnesium (200–400 mg magnesium glycinate or malate nightly) support the GH/IGF-1 axis and are commonly depleted in athletes with high training loads. Not DES-specific; the baseline the signal builds on.
Combinations + timing
Stacking notes + timing windows
DES is highly specific: a short, local IGF-1R pulse. The best pairings add what DES cannot — systemic IGF coverage, satellite-cell activation, or structural repair support. Pairing DES with another IGF variant without a clear division of labor pushes the same lever twice; the stacks below each add a distinct mechanism.
User combinations reasoned from complementary mechanisms — not regimens studied in humans, and DES itself has no human trial. Hypoglycemia risk applies to the whole DES cycle; it does not diminish with stacking. Doses are community convention.
IGF-1 DES + IGF-1 LR3
The classic division of labor: IGF-1 LR3 provides the systemic, all-day base; DES delivers the short, targeted pulse into the worked muscle.
- Why it works:
- LR3 escapes the binding proteins via a different mechanism (Arg3 substitution) and has a long half-life — it provides steady, whole-body IGF-1R stimulation across the full day. DES is site-injected at one muscle, peri-workout, for a brief concentrated hit. The two do not overlap: different timing, different spatial scale, different duration. Two levers, not one lever pushed twice.
- The protocol:
- IGF-1 DES 50–100 mcg injected into the target muscle peri-workout (post-training, 3–5× per week on training days); IGF-1 LR3 20–60 mcg subcutaneously once daily (morning or post-workout, rotated sites, not into the same location as DES). Run together on a 4–6 week cycle.
- Outcome:
- The combination users reach for on focused local hypertrophy goals — DES to build a specific muscle, LR3 for systemic anabolic environment. The hypoglycemia caution applies to both, compounded; glucose management is paramount.
IGF-1 DES + MGF / PEG-MGF
Mechano Growth Factor activates satellite cells (the muscle's stem cells); DES drives the downstream proliferation signal. Together they cover the full sequence of local muscle repair.
- Why it works:
- MGF (or its longer-acting form PEG-MGF) is released locally after mechanical load and triggers satellite-cell activation — the first step in muscle repair and growth. DES drives IGF-1R → Akt/mTOR once those satellite cells are activated. Sequential signaling: MGF opens the door, DES builds through it.
- The protocol:
- Immediately post-training, into the worked muscle: MGF 200–400 mcg (or PEG-MGF 100–200 mcg, which has longer local residence), followed within 15–30 minutes by IGF-1 DES 50–100 mcg at the same or adjacent site. If using PEG-MGF, it can be dosed 2× per week (its pegylation extends the action window); DES is dosed every training session.
- Outcome:
- The pairing used when the goal is local hypertrophy in a specific muscle — satellite-cell activation + proliferation signal in the same window. Both are site-injected; neither provides systemic coverage.
IGF-1 DES + BPC-157 / TB-500 (injury context)
For acute muscle tears or injuries: DES's growth signal on a foundation of structural repair support from BPC-157 and TB-500.
- Why it works:
- BPC-157 promotes angiogenesis (new blood vessel growth) and gut-lining repair; TB-500 (Thymosin β4) drives cell migration and tissue remodeling into damaged sites. DES adds the proliferation/growth signal on top of the structural scaffold they provide. Three different jobs — repair infrastructure, cell migration, and growth signaling — not redundant.
- The protocol:
- BPC-157 250–500 mcg subcutaneously once or twice daily (near the injury site, rotated); TB-500 on its own loading schedule (commonly 2–2.5 mg twice weekly for 4–6 weeks, then maintenance); IGF-1 DES 50–100 mcg injected into the recovering muscle on training days or light-activity days as tolerated.
- Outcome:
- Reached for on muscle tears, partial avulsions, or severe DOMS with underlying structural damage. The DES hypoglycemia caution applies even in a recovery context — do not inject fasted and keep carbohydrates on hand regardless of whether a full workout follows.
Reconstitution math
Reconstitution calculator
Reconstitution calculator
Calculated for a 1 mL U-100 insulin syringe (100 units/mL).
Units per dose
10
Draw to this mark on a U-100 syringe
- Volume per dose
- 0.1 mL
- Doses per vial
- 10
- Concentration
- 1 mg/mL
One vial lasts
- Daily
- 10 days
- Every other day
- 20 days
- 5×/week
- 14 days
Research use only. Not for human consumption. Outputs are reference values based on research literature — verify all measurements independently.
From the studies
Side effects from research
There is no human safety data for IGF-1 DES — the points below come from animal studies and from what is known about the IGF-1 axis generally.
Hypoglycemia (low blood sugar) is the best-documented and most immediate risk, and it is worse with DES than with native IGF-1 or LR3: in pigs and monkeys, DES produced the strongest and longest-lasting glucose drop of all the variants tested, and the risk is magnified further when stacked with insulin. The theoretical cancer-promotion concern that applies to the whole IGF-1 axis applies here too — sustained IGF-1-receptor signaling tells cells to divide and resists their programmed death — and has not been studied for DES specifically. No human organ-overgrowth or long-term data exist.
Sources:PMID 9415072PMID 12745670
As reported in literature
Research dosing ranges
These are doses from the published studies — all animal or cell-culture, since no human data exist. They are shown separately so research figures are never mistaken for a human dose. The recurring theme is potency: DES repeatedly outperforms native IGF-1 at a fraction of the dose, and is the strongest IGF variant tested at dropping blood glucose. No reliable human half-life has ever been published, so the popular '~20–30 minute' figure is omitted as unsourced.
| Dose | Route | Model | Outcome | Sources: |
|---|---|---|---|---|
| 3 µg vs 30 µg IGF-1 | Injection (~3 wk) | Mouse (GH-deficient lit/lit) | DES at 3 µg matched IGF-1 at 30 µg on growth — ~10× more potent | PMID 2280209 |
| In vitro | Cell-culture media | Cultured cells | ~10× more potent than IGF-1 at proliferation + hypertrophy | PMID 8930132 |
| 42–270 µg/kg | IV bolus | Marmoset monkey | Most potent + most prolonged hypoglycemia of all variants tested | PMID 9415072 |
| 20–50 µg/kg | IV bolus | Pig | 2–3× more potent glucose-lowering; 4–8× greater hypoglycemia over 4 h | PMID 9415072 |
| Systemic | In vivo | Diabetic rat (retina) | Normalized IGF-1R and phospho-Akt signaling | PMID 12745670 |
Quick answers
Frequently asked
What is IGF-1 DES?
It is a naturally-occurring truncated form of IGF-1 — native IGF-1 with its first three amino acids (Gly-Pro-Glu) removed, leaving 67 residues. The body makes a small amount this way by enzyme trimming. It is sold as a research reagent, not a medicine.
Why is IGF-1 DES more potent than regular IGF-1?
Removing the position-3 glutamate abolishes its binding to the IGF-binding proteins that normally soak up IGF-1. With no carrier sponge holding it back, far more DES is free to activate the receptor — roughly ten times more potent than native IGF-1 in cells and in growth-hormone-deficient mice.
What is the difference between IGF-1 DES and IGF-1 LR3?
Opposite designs. DES is truncated (67 AA), more potent, and short-acting — used for a brief, timed, site-injected pulse into the worked muscle. LR3 is extended (83 AA) and long-acting — used for steady, whole-body exposure. Both escape the binding proteins; DES is the strong-but-brief one, LR3 is the long one.
Is IGF-1 DES an approved drug?
No. It has no approved human therapeutic use and has never been tested in humans as a therapy. It is a research reagent, and it is prohibited in sport by WADA (Section S2, peptide hormones and growth factors). This page presents research literature only and makes no medical claims.
How is IGF-1 DES commonly dosed?
No human trial has set a dose. In the user community the common pattern is 50–150 mcg per training session by subcutaneous injection into the worked muscle, peri-workout. Treat that as convention extrapolated from animal research, not a recommendation — see the Dosing & Protocol section.
Why is the hypoglycemia risk highest with DES compared to other IGF variants?
Because DES is the most potent IGF variant at lowering blood glucose — demonstrated in animal studies where it produced the strongest and longest-lasting glucose drop compared to native IGF-1 and other variants. It escapes the binding proteins that buffer native IGF-1's glucose-lowering action, so more of its effect hits unchecked. Always have carbohydrates on board when using DES.
Primary sources
References
- PMID 2539101Ross et al. 1989 (IGFBPs do not inhibit DES)
- PMID 8930132des(1-3)IGF-1 potency review
- PMID 2280209Gillespie et al. 1990 (lit/lit mice)
- PMID 9415072Tomas et al. 1997 (hypoglycemia potency)
- PMID 7561610Yamamoto & Murphy 1995 (endogenous formation)
- PMID 12745670des(1-3)IGF-1 IGF-1R/Akt in vivo
- UniProt P05019UniProt P05019 (native IGF-1)
- WADA S2WADA Prohibited List S2
Reviewed by Ki Researcher Team · Research use only · Not medical advice · Updated 2026-06-01